Protein Info for GFF3158 in Variovorax sp. SCN45

Annotation: Sulfite dehydrogenase (quinone), iron-sulfur subunit SoeB (EC 1.8.5.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12800: Fer4_4
  • amino acids 41 to 55 (15 residues), 14.6 bits, see alignment (E = 1.7e-05)
  • amino acids 134 to 149 (16 residues), 13.5 bits, see alignment (E = 3.7e-05)
  • amino acids 180 to 191 (12 residues), 11 bits, see alignment (E = 0.00023)
• PF13187: Fer4_9
  • amino acids 43 to 119 (77 residues), 28 bits, E=8.2e-10
• PF13247: Fer4_11
  • amino acids 96 to 197 (102 residues), 87.9 bits, E=2.1e-28
• PF13237: Fer4_10
  • amino acids 100 to 147 (48 residues), 31.5 bits, 6.1e-11
• PF12837: Fer4_6
  • amino acids 128 to 150 (23 residues), 32.1 bits, see alignment (E = 3.5e-11)
• PF12797: Fer4_2
  • amino acids 128 to 148 (21 residues), 29.9 bits, see alignment (E = 1.6e-10)
• PF00037: Fer4
  • amino acids 130 to 151 (22 residues), 35 bits, see alignment (E = 3.8e-12)
• PF12838: Fer4_7
  • amino acids 135 to 192 (58 residues), 28.5 bits, E=7.7e-10

Best Hits

Swiss-Prot: 80% identical to SOEB_ALLVD: Sulfite dehydrogenase subunit B (soeB) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: None (inferred from 90% identity to vap:Vapar_3814)

MetaCyc: 80% identical to SoeB (Allochromatium vinosum)
RXN-15349 [EC: 1.8.5.6]

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain B (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

• formate to dimethyl sulfoxide electron transfer (2/2 steps found)
• sulfite oxidation V (SoeABC) (1/1 steps found)
• NADH to dimethyl sulfoxide electron transfer (1/2 steps found)
• hydrogen to dimethyl sulfoxide electron transfer (1/2 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (4/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3 or 1.8.5.6

Protein Sequence (242 amino acids)

>GFF3158 Sulfite dehydrogenase (quinone), iron-sulfur subunit SoeB (EC 1.8.5.6) (Variovorax sp. SCN45)
MKAVAPSPRPSPASGRGSTATQRAAQGETLAKQLALVIDLNVCVGCHACVTSCKQWNTSG
SAGPLADERPYAANPTGTFFNRVQTYEAGAFPVTETIHFPKSCLHCEDPPCVPVCPTGAS
YKRKEDGIVLVDYDKCIGCKYCAWACPYGARELDEERQVMTKCTLCVDRIYDEQLPKEDR
KPACVKACPTGARIFGDVKDPDSEVSKAIRERGGYQLMPEWETSPANQYLPRHIRQSTAS
EE