Protein Info for PS417_16160 in Pseudomonas simiae WCS417

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 27 to 304 (278 residues), 182.6 bits, see alignment E=5e-58 PF04069: OpuAC" amino acids 47 to 226 (180 residues), 44.1 bits, see alignment E=4.1e-15 PF12974: Phosphonate-bd" amino acids 64 to 197 (134 residues), 37 bits, see alignment E=5.2e-13 PF13379: NMT1_2" amino acids 66 to 247 (182 residues), 29.7 bits, see alignment E=1.1e-10 PF09084: NMT1" amino acids 87 to 245 (159 residues), 53.2 bits, see alignment E=7.8e-18

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 96% identity to pfs:PFLU3721)

Predicted SEED Role

"Alkanesulfonates-binding protein BUT NOT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UMF2 at UniProt or InterPro

Protein Sequence (312 amino acids)

>PS417_16160 ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MTFKKLIVAASLLFAATAAHAEQTLDISYQRSSTLWILLKQNGHLEQRLKPLGFTVNWHE
FSTGLLSSLNAGSVDLHADVADAFALFTQAADAPLTYYAQENSSSSAQAIIVQDQSPIHS
IADLKGKTVAVSKGSGSHYLLISALRKAGLTLADITPRYLEAPDGGAAFANGSVDAWVIW
DPFLATQQLDHHVRVIADGKDGLADYNRFYMATTRFAKAHPDVLQVTFDTLRETGQWVKA
HPKEAAEILGPLWGNIAPATVERANSRRSYDIIPVKVENLAEQQRIADTYYAAKLIPKPL
KVSAITVWTPKP