Protein Info for GFF3150 in Variovorax sp. SCN45

Annotation: Transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF13412: HTH_24" amino acids 10 to 55 (46 residues), 57 bits, see alignment E=1.7e-19 PF13404: HTH_AsnC-type" amino acids 13 to 49 (37 residues), 46.3 bits, see alignment 4.4e-16 PF01037: AsnC_trans_reg" amino acids 75 to 148 (74 residues), 76.3 bits, see alignment E=2.1e-25

Best Hits

Swiss-Prot: 42% identical to BKDR_PSEPU: Bkd operon transcriptional regulator (bkdR) from Pseudomonas putida

KEGG orthology group: None (inferred from 91% identity to vap:Vapar_5805)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>GFF3150 Transcriptional regulator, AsnC family (Variovorax sp. SCN45)
MNVGSVSLDEHCLKILSALQHDGRQTVQQISETIGLSPTPCWKRIKDMEAAGVIRGYTTL
VDPEQVGLHVSAVAEVNLDRHSEAMVQRFEEAVAASPQIIRCVSATGPADYILNVTVPDM
KHYERFLHEVLFSLPGVTHVRSSIVLREIKSETALPLDHLLPGTPGKPRATGSRRS