Protein Info for GFF3142 in Xanthobacter sp. DMC5

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 9 to 282 (274 residues), 398.4 bits, E=3.8e-123
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 11 to 628 (618 residues), 808.2 bits, E=2.5e-247
• PF02779: Transket_pyr
  • amino acids 319 to 480 (162 residues), 161.7 bits, E=3.5e-51
• PF02780: Transketolase_C
  • amino acids 499 to 622 (124 residues), 89.4 bits, E=4.5e-29

Best Hits

Swiss-Prot: 90% identical to DXS_XANP2: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 90% identity to xau:Xaut_4733)

MetaCyc: 56% identical to 1-deoxy-D-xylulose-5-phosphate synthase (Croton stellatopilosus)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• isoprene biosynthesis I (8/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Protein Sequence (643 amino acids)

>GFF3142 1-deoxy-D-xylulose-5-phosphate synthase (Xanthobacter sp. DMC5)
VTLLKTPLLDTIREPADVRRLPQEKLAQLAAELRAETIDAVSVTGGHLGAGLGVVELTVA
LHHVFNTPHDRLIWDVGHQCYPHKILTGRRERIRTLRTGGGLSGFTNRAESEYDPFGAGH
SSTSISAGLGMAVARDLGGGERNVVAVIGDGAMSAGMAYEAMNNAGAMDSRLIVILNDND
MSIAPPTGAMSAYLARLISGQTYRSLREIGKQIAGHLPKFVERGAQRAEEFARGFWTGGT
LFEELGFYYVGPIDGHNLDHLLPVLKNVRDAKTGPILVHVVTQKGKGYGPAEQSADKYHG
VVKFDVVTGAQVKAKSNAPSYTRVFAESLISEARRDPKIVAITAAMPSGTGIDLFGQAYP
DRTFDVGIAEQHAVTFAGGLAAEGFKPFCALYSTFLQRAYDQVIHDVALQGLPVRFIVDR
AGLVGADGATHAGAYDLAYLGCLPGMVLMSPADEAELMHMIATAVAYDDGPSAVRFPRGE
GVGVERPDRAEALPIGKGRMVRGTGEGDVAILSLGTRLAAALEAAERLEAAGFAVTVADA
RFAKPIDRDLALKLASGHSALVTVEEGSIGGFGSQVLQFLTDEGVLDRGTVKVRSMVLPD
IYIDHDTQARQIAEAGLDANAIVAKVEGLLGKAKAGRELSRAG