Protein Info for GFF3140 in Sphingobium sp. HT1-2

Annotation: Adenylate kinase (EC 2.7.4.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01351: adenylate kinase
  • amino acids 2 to 213 (212 residues), 242.9 bits, E=1.3e-76
• PF13671: AAA_33
  • amino acids 3 to 127 (125 residues), 32.3 bits, E=2.3e-11
• PF00406: ADK
  • amino acids 5 to 191 (187 residues), 174.1 bits, E=4.5e-55
• PF13207: AAA_17
  • amino acids 6 to 126 (121 residues), 84.2 bits, E=2.2e-27
• PF05191: ADK_lid
  • amino acids 127 to 163 (37 residues), 51.4 bits, 1.5e-17

Best Hits

Swiss-Prot: 84% identical to KAD_SPHWW: Adenylate kinase (adk) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 90% identity to sjp:SJA_C1-06480)

MetaCyc: 43% identical to adenylate kinase 1 (Saccharomyces cerevisiae)
Adenylate kinase. [EC: 2.7.4.3]; (Deoxy)adenylate kinase. [EC: 2.7.4.3, 2.7.4.11, 2.7.4.13]

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• superpathway of purine nucleotide salvage (11/14 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.11 or 2.7.4.13 or 2.7.4.3

Protein Sequence (218 amino acids)

>GFF3140 Adenylate kinase (EC 2.7.4.3) (Sphingobium sp. HT1-2)
MNIILLGPPGAGKGTQATRLVDSRGMVQLSTGDMLRAAVKAGTPVGLQAKALMESGSLVP
DEVVSGIIGEALDALAADTGVIFDGYPRTEAQAHSLDTILADRGRTLDHVIELEVDEDAL
VERITGRFTCATCGEGYHDVFKQPKVEGTCDKCGGHEFKRRPDDNEETVRTRMAEYRAKT
APILPIYEARGIVSRVDGMADMNDVSGAIVAILDGAPA