Protein Info for GFF3136 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 163 to 180 (18 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 221 to 252 (32 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 13 to 315 (303 residues), 81 bits, see alignment E=4.4e-27

Best Hits

KEGG orthology group: None (inferred from 76% identity to sch:Sphch_1806)

Predicted SEED Role

"acyltransferase 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>GFF3136 hypothetical protein (Sphingobium sp. HT1-2)
MVETKPKRTRLTELDALRGIGALCVLVFHYSTRFHELFPQASHVPFSFPGGNYRVLLFFT
ISGFAIFFTLDRIGTVADFIVNRFARLYPAYLVAMLVTLSIEYLAQATQLLVGPFAILAN
LTMLQGFAFIPEVDGAYWTLTVEIAFYFCMVSIWKWIGLRHLEPTLVAWLILRWVMQLWP
DIVPERVVMLLVLRYTPFFIIGMLAYRIWAGQRSWQQQAPYAALALLSIATMETWDVTIV
GLVLMATFAALIRNHLRFLAIRPLVWMGGISYSFYLIHQHVGFVVMLEIARAGYSPWIGF
AAAFLVALTLGTLINRLVERPAGEIILRWWKKRRRAPGPLAEIAPSG