Protein Info for PS417_16045 in Pseudomonas simiae WCS417

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF02771: Acyl-CoA_dh_N" amino acids 27 to 93 (67 residues), 33.7 bits, see alignment E=8.4e-12 PF02770: Acyl-CoA_dh_M" amino acids 132 to 222 (91 residues), 42.5 bits, see alignment E=1.2e-14 PF08028: Acyl-CoA_dh_2" amino acids 261 to 369 (109 residues), 40.3 bits, see alignment E=7.7e-14 PF00441: Acyl-CoA_dh_1" amino acids 261 to 367 (107 residues), 36 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU3692)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7Z1 at UniProt or InterPro

Protein Sequence (392 amino acids)

>PS417_16045 acyl-CoA dehydrogenase (Pseudomonas simiae WCS417)
MSQSSHPALRSVEVAHFEALLERLTVELASTAHLYDESGAFPHANFQLLHQHGLVALTVP
KAFGGGGASLLQARKAISAIAKGEPSTALILVMQYLQHTRLQDSKTWPAHLRTQVAEDAV
RNGALINALRVEPDLGTPARGGLPATTAIRTAEGWRISGRKVYSTGSHGLSWLSVWGRSD
DADPLVGAWLVPKDSPGVTIIDTWDHLGMRATCSHEVVLDNVLVPLDHAVSVSPWSAPTP
ELDGEGLLWMSVLLSSVYDAVAQAARDWLVNWLEARTPSNLGAALSSLPRFQETVGHIDT
LLFANRSLLDAAAEGHTPAANAAQLKYLVTHNAIRAVELAIEASGNPGLSRHSPLQRHYR
DVLCSRVHTPQNDAVLQGIGKAVFVQRQKERT