Protein Info for GFF3125 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 63 (27 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 95 to 112 (18 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 148 to 175 (28 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details PF04955: HupE_UreJ" amino acids 17 to 197 (181 residues), 54.3 bits, see alignment E=6.3e-19

Best Hits

KEGG orthology group: None (inferred from 72% identity to xau:Xaut_2124)

Predicted SEED Role

"HupE-UreJ family metal transporter" in subsystem Transport of Nickel and Cobalt or Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>GFF3125 hypothetical protein (Xanthobacter sp. DMC5)
MTRLVRRAGKAGALALVFALTPGLAHAHLVDTRLGDFYAGALHPLTDFEQVLPWLALAVL
AAFQGPRVARWVVLAFPLALAAGGALSLVLPPPPFAPVAGVALVALTGLAVAAQLRLPLA
ALLVLAVGLGLLDGYQNGAAMVATTDRFLFLSGVTVIGYAFVTLALGCAVAFLAGVGGWR
PIALRAAGSWVAAVGIMVLGLHLMSRGVG