Protein Info for GFF3124 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details PF04955: HupE_UreJ" amino acids 17 to 193 (177 residues), 202.1 bits, see alignment E=2.6e-64

Best Hits

KEGG orthology group: K03192, urease accessory protein (inferred from 76% identity to xau:Xaut_2123)

Predicted SEED Role

"HupE-UreJ family metal transporter" in subsystem Transport of Nickel and Cobalt or Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>GFF3124 hypothetical protein (Xanthobacter sp. DMC5)
MKSQSPNPALVLAGLLAMIPLSPALAHTGTGVQIGLQSGFLHPLTGADHVIAMVAVGLWG
AQLGNPAIWVLPITFPLVMAVGGLIGVMGIDLPFVELFIALSGIALGAMVAFNVRPPLWV
AATIVGVFAIFHGYAHGKELPDAADAVAFAVGFVVATGMLHLLGILIGVAVRWEAGAKAV
RACGAAIGCLGVYFLLGAIGIIE