Protein Info for GFF3120 in Sphingobium sp. HT1-2

Annotation: RecA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR02012: protein RecA" amino acids 17 to 336 (320 residues), 576.9 bits, see alignment E=6e-178 PF00154: RecA" amino acids 20 to 281 (262 residues), 490.2 bits, see alignment E=3e-151 PF08423: Rad51" amino acids 48 to 240 (193 residues), 36.5 bits, see alignment E=6.8e-13 PF06745: ATPase" amino acids 53 to 209 (157 residues), 29.1 bits, see alignment E=1.3e-10 PF21096: RecA_C" amino acids 284 to 338 (55 residues), 87.1 bits, see alignment 1.4e-28

Best Hits

Swiss-Prot: 85% identical to RECA_ZYMMO: Protein RecA (recA) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03553, recombination protein RecA (inferred from 95% identity to sjp:SJA_C1-32810)

MetaCyc: 68% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>GFF3120 RecA protein (Sphingobium sp. HT1-2)
MTAMLSLIDSKKTGTMDRQKALEAALAQIDRAFGKGSAMKLGSREKIEIESISTGSLGLD
IALGIGGLPKGRIIEIYGPESSGKTTLTLHAIAEAQKAGGTAAFVDAEHALDPIYAKKLG
VDIDELIVSQPDTGEQALEIVDTLVRSNAIDILVVDSVAALVPRAEIEGEMGDSHVGLQA
RLMSQALRKLTGSIARSKCMVIFINQVRMKIGVMYGNPETTTGGNALKFYASVRLDIRRT
GQIKDRDDIVGNATRVKVVKNKVAPPFKQVEFDIMYGEGISKIGEMLDIGVKAGLVEKSG
SWFSYDSVRIGQGRENAKTFLKENPEMADRLEKAIRGKTEEVAEGMMAGPEAGDDD