Protein Info for GFF312 in Sphingobium sp. HT1-2

Annotation: Vitamin B12 ABC transporter, permease protein BtuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 34 (5 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 230 to 258 (29 residues), see Phobius details amino acids 269 to 292 (24 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details PF01032: FecCD" amino acids 8 to 318 (311 residues), 277.1 bits, see alignment E=1.7e-86 PF00950: ABC-3" amino acids 53 to 281 (229 residues), 23.1 bits, see alignment E=4.9e-09

Best Hits

Swiss-Prot: 43% identical to BTUC_VIBCH: Vitamin B12 import system permease protein BtuC (btuC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 82% identity to sch:Sphch_1713)

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>GFF312 Vitamin B12 ABC transporter, permease protein BtuC (Sphingobium sp. HT1-2)
LLPGLIALLLVAGIASVALGSVTIAPARILSVLAGGGDMVARAIVIDLRLPRMAIGLLVG
AMLGLSGAALQGYLRNPLAEPAVLGVSNAAALGAVIALYFGLSELHPMALPLLAIVTALA
AIGALFLLAGPSESPLTLILAGIAVATLAGAGISLALNLSPNPFAAMEIMSWLMGSLENR
SIDHLLLALPCIAVGAALLLYDGRALDALTLGEDGARALGVDLSRARLRLMAGVAIGVGG
AVAVTGSIGFVGLIVPHLVRPLTDRSPSALLLPSMLGGAVLLTLADIGVRIIPTSSELKL
GVLTAILGVPVFLIHLMRERRLW