Protein Info for GFF3117 in Variovorax sp. SCN45

Annotation: Beta-phosphoglucomutase (EC 5.4.2.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF00702: Hydrolase" amino acids 13 to 189 (177 residues), 83.8 bits, see alignment E=4.3e-27 PF13419: HAD_2" amino acids 16 to 195 (180 residues), 80.3 bits, see alignment E=3.7e-26 PF13242: Hydrolase_like" amino acids 150 to 205 (56 residues), 29.1 bits, see alignment E=1.6e-10 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 150 to 195 (46 residues), 47.3 bits, see alignment 1.3e-16

Best Hits

KEGG orthology group: None (inferred from 90% identity to vap:Vapar_3792)

Predicted SEED Role

"Beta-phosphoglucomutase (EC 5.4.2.6)" in subsystem Maltose and Maltodextrin Utilization or N-Acetyl-Galactosamine and Galactosamine Utilization or Trehalose Uptake and Utilization (EC 5.4.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>GFF3117 Beta-phosphoglucomutase (EC 5.4.2.6) (Variovorax sp. SCN45)
MSLKSPTDGGKVEAFIFDMDGTMIDSMPWHARSWVEFAQNHGVKLDVSEILARTTGRTGT
ESMRELFERELSDAECQALVHEKEEIYRAMFHDNFTEVAGFTAFARAAETRGLKVAVGTA
GDRHNIEFAMSRLKMDPLPLAIVGGDEGFTGKPTPAIFLEAARRIGVAPERCIVFEDAPF
GIEAARRGGMRAVAVCSTHTAAELAGPHVIAAVRDYNELAHSNFLETLDAAA