Protein Info for PS417_15945 in Pseudomonas simiae WCS417

Annotation: quercetin 2,3-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF02678: Pirin" amino acids 22 to 127 (106 residues), 116.5 bits, see alignment E=8.7e-38 PF17954: Pirin_C_2" amino acids 180 to 248 (69 residues), 26.5 bits, see alignment E=9.1e-10 PF05726: Pirin_C" amino acids 182 to 284 (103 residues), 106.8 bits, see alignment E=1.1e-34

Best Hits

Swiss-Prot: 65% identical to Y2418_PSEAE: Putative quercetin 2,3-dioxygenase PA2418 (PA2418) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06911, (no description) (inferred from 96% identity to pfs:PFLU3640)

Predicted SEED Role

"Pirin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGP0 at UniProt or InterPro

Protein Sequence (288 amino acids)

>PS417_15945 quercetin 2,3-dioxygenase (Pseudomonas simiae WCS417)
MKKLIGIYTSPRAHWVGDGFPVRTLFSYDTMGKHISPFLLLDHAGPADFTPTEQRRGVGQ
HPHRGFETVTIVYDGEVEHRDSTGAGGKIGPGDVQWMTAAKGILHEEFHSAAFARSGGKL
EMVQLWVNLPAKDKMADAGYQTLVDGDIPVLPLANDAGQLRLIAGEFAGTQGPARTFTPI
DVWDLRLNAGKPVTLDLHAGRNTALVILRGTVLVNGEEVARQGQLALFERDGSQLTLESN
DDAKVLLLSGEPIDEPIVGHGPFVMNTEQEIHQAFADFQSGKFGQMQI