Protein Info for GFF3115 in Variovorax sp. SCN45

Annotation: Methionine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR00363: lipoprotein, YaeC family" amino acids 16 to 269 (254 residues), 257.4 bits, see alignment E=8.5e-81 PF03180: Lipoprotein_9" amino acids 34 to 271 (238 residues), 292.9 bits, see alignment E=7.1e-92

Best Hits

Swiss-Prot: 44% identical to METQ_VIBCH: Probable D-methionine-binding lipoprotein MetQ (metQ) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02073, D-methionine transport system substrate-binding protein (inferred from 90% identity to vpe:Varpa_4377)

Predicted SEED Role

"Methionine ABC transporter substrate-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation or Staphylococcal pathogenicity islands SaPI

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>GFF3115 Methionine ABC transporter substrate-binding protein (Variovorax sp. SCN45)
MHSTFRRRSLFAVTLAAALFGAGGAALAQDKNNIKVGVSVGNGEQIFEVVKKVAAKDGLN
IQVVVFNDYQLPNAALASGDLDANAFQHQPFLDNQIKARGFDLVPVGLTITAPLGFYSHK
IKSIDQLADGASVGIQNDPSNGNRALLLLQQAGLITLKPEAVKNNNATPLDVVTNPKKLK
LVALDAAQLPRSLDDLAIAAINNDYAEKAGLSFNKDAVIKESPKSPYANLIAVRRADKDK
PWAKRLVAAYQSPEVKSFIETQFKGSLIPAF