Protein Info for GFF3110 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Anthranilate phosphoribosyltransferase (EC 2.4.2.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details PF02885: Glycos_trans_3N" amino acids 12 to 73 (62 residues), 59 bits, see alignment E=3.2e-20 TIGR01245: anthranilate phosphoribosyltransferase" amino acids 15 to 346 (332 residues), 417.2 bits, see alignment E=2.5e-129 PF00591: Glycos_transf_3" amino acids 83 to 338 (256 residues), 307.8 bits, see alignment E=6.7e-96

Best Hits

Swiss-Prot: 86% identical to TRPD_POLSJ: Anthranilate phosphoribosyltransferase (trpD) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 86% identity to pol:Bpro_4452)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.18

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>GFF3110 Anthranilate phosphoribosyltransferase (EC 2.4.2.18) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSPTSAHKITPQEALQRTIEHREIFHDEMLHLMRLIMSGEMSPVMMAALITGLRVKKETI
GEITAAAQVMREFSTKVHVADKTHLVDIVGTGGDGSHTFNISTCAMFVAAAAGARVSKHG
GRSVSSKSGSADVLESLGVNINLAPEAIARCIEQVGVGFMFAPNHHPAMKNVAPVRRELG
IKTIFNILGPLTNPASAPNILMGVFHPDLVGIQVRALQRLGAEHAVVVYGRDGMDEVSLG
AATLVGELRNGEITEYEIHPEDFGMTMASSRALRVETPEASRQMLLGVLESRDDPSFKAA
SEIVALNAGVALYAANVAADMGAGIALARRTLASGAALAKLEQLKAFVA