Protein Info for GFF3107 in Xanthobacter sp. DMC5

Annotation: Secretin XpsD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 742 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF21305: type_II_gspD_N0" amino acids 89 to 154 (66 residues), 51.2 bits, see alignment E=1.4e-17 TIGR02517: type II secretion system protein D" amino acids 89 to 717 (629 residues), 446.1 bits, see alignment E=9.6e-138 PF03958: Secretin_N" amino acids 184 to 243 (60 residues), 37.2 bits, see alignment 4.1e-13 amino acids 250 to 316 (67 residues), 30.1 bits, see alignment E=7.1e-11 amino acids 322 to 463 (142 residues), 41.5 bits, see alignment E=1.9e-14 PF00263: Secretin" amino acids 537 to 709 (173 residues), 156.7 bits, see alignment E=6.3e-50

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 74% identity to xau:Xaut_2106)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (742 amino acids)

>GFF3107 Secretin XpsD (Xanthobacter sp. DMC5)
LTCAILFAAILSGCSGIMDDTKPQSTFDQVRNIDLSPKPMQPVAQPQQPTDNRQPIEYFA
TPGAQPVTDPAAVGAAGTAQRGADGGYDLNFENTPVTTVAKVVLTDILGANVIIDPRVQG
TISLSSARPVARTDLAYVLESALRSNGIALVKDASGYQLMPLTEAAGSGATDVGTSRPEP
GYGVSVVPLRYVSAETLMPVIDSFATRAGMVRVDPGRNVLLIQGTAQERQAAINTALSFD
ADWMRGQSVGIYPLRNSAPEPLIAELETLLDAGEGGLSHKMVKFQAINRMNSVMVVAKKP
DLLRTAATWIERLDRSDSSVGVRVYRLRYGEARQTARVLNELFNGTSSQGLDQASNQIAP
GSGSSASSNGGGSNGPMSVQQRLGQTPTQNQGQGGQNAQPVNRGETDNELQGGSGPSGGG
GAILSGIRITADQVNNSLLIYASQENYRIIERTLLQLDQPQLQVAIEATVAEVTLNDQLA
YGVQFFLTSKDLGLGKNNGSAVNTLSSEITNQAINRVLPGFNLLIGRENQPKMILDALHT
VTDVKVLSNPSVVVVDNQKATLQVGDEVPVSTGSATVLTSSNTVVNTIEYKNTGIILHVT
PRVNVNGQVRLDIEQEISNVTKQPTANGSSSDGSTLTPTVSQRRVKSTIAVTSGQTVLLA
GLISERSDGVRQGVPVLDQIPGVGDAFAHKDTTVKRTELIIFIRPQIIRDNMDAHTVAEE
LRAKLKGSVGVLPGGPQPLINR