Protein Info for PS417_15885 in Pseudomonas simiae WCS417

Annotation: GCN5 family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 PF00583: Acetyltransf_1" amino acids 38 to 119 (82 residues), 37.8 bits, see alignment E=3.2e-13 PF13508: Acetyltransf_7" amino acids 46 to 119 (74 residues), 35.2 bits, see alignment E=1.9e-12 PF13673: Acetyltransf_10" amino acids 49 to 123 (75 residues), 28.5 bits, see alignment E=2e-10

Best Hits

Swiss-Prot: 33% identical to ATSE_AGRFC: Acetyltransferase Atu2258 (Atu2258) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 90% identity to pfs:PFLU3630)

Predicted SEED Role

"PhnO protein" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2S7 at UniProt or InterPro

Protein Sequence (141 amino acids)

>PS417_15885 GCN5 family acetyltransferase (Pseudomonas simiae WCS417)
MDIPLIEISDQPNPEVERLLGSGLAAFNESITGYNDRQPLTVLIKDPATQQIVGGITGKT
TLGMAFLDLFHLPEHLRGSGLGSQLLQAFENEARRRGCRNAVLYTLSFQAPGFYEKHGWL
KFGEVPCAPEGSSRVFLSKPL