Protein Info for GFF3100 in Xanthobacter sp. DMC5

Annotation: GTP cyclohydrolase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01227: GTP_cyclohydroI
  • amino acids 60 to 237 (178 residues), 247.4 bits, E=3.1e-78
• TIGR00063: GTP cyclohydrolase I
  • amino acids 61 to 238 (178 residues), 221.1 bits, E=4e-70

Best Hits

Swiss-Prot: 78% identical to GCH1_AZOC5: GTP cyclohydrolase 1 (folE) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 91% identity to xau:Xaut_1649)

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• preQ₀ biosynthesis (3/4 steps found)
• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
• superpathway of chorismate metabolism (41/59 steps found)
• tetrahydromonapterin biosynthesis (1/4 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.16

Protein Sequence (241 amino acids)

>GFF3100 GTP cyclohydrolase 1 (Xanthobacter sp. DMC5)
MDAVVKLFKAQAENEERERQLKAKAAAALRAPAPDGAPAAPKVHPPLADGSPRPTRAQAE
AAVKTLLAYIGEDPAREGLLDTPKRVVKAYDELFSGYGEDADALLDRTFGEIGTFDDFVL
VRDIPFHSHCEHHMVPFVGKAHIAYFPVERVVGLSKIARVVDIFARRLQTQEHLTSQITN
ALDEGLRPRGVAVMIEAEHMCMSMRGITKQGVSTLTTQFTGVFRDDPAEQVRFITLVRSK
G