Protein Info for PS417_15840 in Pseudomonas simiae WCS417

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 TIGR00229: PAS domain S-box protein" amino acids 9 to 119 (111 residues), 44.3 bits, see alignment E=1.9e-15 PF00989: PAS" amino acids 10 to 116 (107 residues), 57.7 bits, see alignment E=3.3e-19 PF13188: PAS_8" amino acids 11 to 49 (39 residues), 21.7 bits, see alignment 4.5e-08 PF08448: PAS_4" amino acids 13 to 116 (104 residues), 29.3 bits, see alignment E=2.7e-10 PF13426: PAS_9" amino acids 18 to 117 (100 residues), 55 bits, see alignment E=2.6e-18 PF08447: PAS_3" amino acids 30 to 114 (85 residues), 31.3 bits, see alignment E=6.2e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 129 to 290 (162 residues), 153.7 bits, see alignment E=3.7e-49 PF00990: GGDEF" amino acids 132 to 288 (157 residues), 176.3 bits, see alignment E=1.2e-55

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGM0 at UniProt or InterPro

Protein Sequence (319 amino acids)

>PS417_15840 histidine kinase (Pseudomonas simiae WCS417)
MIENDQQVLVRALDAATNPVLITERSGSIVWLNKAFCLMSGYSKQELVGKTPHLLSSGRQ
STTFYRNLWMTIMAGLSWQGEMVERRKDGGTCTVNQIITPVLDQDGVVTHFIAILHNFSL
IDEERAAMQQLAFHDALTGLPNRLLFLNLLNQAINGAIKYKQPLALMFIDLDHFKSINDT
LGHACGDRLLVAVAERLGQSVRRSDVVARLSGDEFAILISGVDQIDQLEPLANKLVAAIH
QPFMVDNHRIETAISIGISLFHGDGSSVDDLLAQADSAMYQAKRNGGNGCRFSVLDIPAE
LNAARCPPTWPASATPGPG