Protein Info for GFF3092 in Xanthobacter sp. DMC5

Annotation: NAD kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF01513: NAD_kinase" amino acids 14 to 81 (68 residues), 35.6 bits, see alignment E=1.1e-12 PF20143: NAD_kinase_C" amino acids 117 to 210 (94 residues), 45.1 bits, see alignment E=8.4e-16

Best Hits

Swiss-Prot: 63% identical to NADK_PARL1: NAD kinase (nadK) from Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 90% identity to xau:Xaut_1643)

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>GFF3092 NAD kinase (Xanthobacter sp. DMC5)
MSEPRFQRIAFVSSQTPEAETARERLIARYGEVAEEDADVVVALGGDGLMLQTLHRFRER
TLPIYGMHRGSVGFLMNTFREEGLVERLTAAQQVTIHPLMMEAVTSTGMRHRAPAFNEVS
LLRQSYQAAKLRISIDGKMRLEELICDGIIVATPAGSTAYNLSAHGPILPLGTALLALTP
ISPFRPRRWRGALVPDRARIDIAVMEADKRPVSAAADHFEVRDIIAVSARLDTTSSVDML
FDPDHGLDERILREQFVY