Protein Info for GFF309 in Sphingobium sp. HT1-2

Annotation: '16S rRNA (cytidine(1402)-2'-O)-methyltransferase (EC 2.1.1.198)' transl_table=11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 13 to 276 (264 residues), 224.1 bits, see alignment E=1.1e-70 PF00590: TP_methylase" amino acids 13 to 210 (198 residues), 112 bits, see alignment E=4.1e-36 PF23016: RsmI_C" amino acids 236 to 280 (45 residues), 53.7 bits, see alignment 1.4e-18

Best Hits

Swiss-Prot: 56% identical to RSMI_ERYLH: Ribosomal RNA small subunit methyltransferase I (rsmI) from Erythrobacter litoralis (strain HTCC2594)

KEGG orthology group: K07056, (no description) (inferred from 93% identity to sch:Sphch_1710)

MetaCyc: 45% identical to 16S rRNA 2'-O-ribose C1402 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11637 [EC: 2.1.1.198]

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.198

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>GFF309 '16S rRNA (cytidine(1402)-2'-O)-methyltransferase (EC 2.1.1.198)' transl_table=11 (Sphingobium sp. HT1-2)
METILASGLEPGLYIVAGPIGNLGDLTPRAAEVLRLADVVAVEDTRVSARLLRHAGSDRP
MIPYHDHSAENVRQRLIERMASESVALLSDAGTPLISDPGYKLVRDARAAGRKITTLPGP
SAAIAALTLSGLPTDRFLFMGFLPNKAKARGDVLAEVVALRATLVFYESGPRLSDSLAAM
AAALGDREAAVSREISKTFEETATGTLTELSARYADAPPKGEIVVIVGPPGEAPPASAED
ADAALREALTRLPVSKAAGEVAKKLGLDRRTLYDRANELKGEREA