Protein Info for GFF3084 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG00553873: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01946: Thi4
  • amino acids 23 to 78 (56 residues), 27.1 bits, 3.6e-10
• PF00890: FAD_binding_2
  • amino acids 31 to 63 (33 residues), 21.7 bits, see alignment (E = 1.6e-08)
• PF01266: DAO
  • amino acids 31 to 385 (355 residues), 191.5 bits, E=4.8e-60

Best Hits

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 99% identity to spt:SPA2996)

Predicted SEED Role

"FIG00553873: hypothetical protein"

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.-

Protein Sequence (433 amino acids)

>GFF3084 FIG00553873: hypothetical protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNTKIDALNYYGATKKYPLHFPALQDDIDADVVIIGGGFSGINTALELAEQGITNVVVLE
ARHLGYGGTGRNGGQVMAGIGHDIEAVKKYVGAAGMETLFKISNLGAGIIRERIRKYHID
ADFVPGYGYLAYNQRQLKTLQQWEKEFKAATPEDDIELYTGKDVQQVIGSDVYCGVLKHM
GGGHVHSLNLLLGSAQAANSLGVKIFEYSPVVEVSYGKTVRVRTAMGSVKAAKLLWACDS
FLNNLEPEIYKKTLVTYSYQVSTEPLSSELVERISPLRGAFSDIRPVINYYRLTKENRLL
FGSATRFLEYTPHDFAAWNRTLLTEVFPYLKDVKIDFAWGGPMACSANLFPQIGTLREHN
NVFYVQGYSGFGVTPSHIVCKILAEGINGGSERYRLMSSIPHATIYGRDSLRLLLVSAGK
LIHQTAGFWKGRN