Protein Info for GFF3081 in Xanthobacter sp. DMC5

Annotation: Tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF02899: Phage_int_SAM_1" amino acids 14 to 92 (79 residues), 72 bits, see alignment E=4e-24 PF00589: Phage_integrase" amino acids 153 to 304 (152 residues), 131.5 bits, see alignment E=2.8e-42

Best Hits

Swiss-Prot: 53% identical to XERD_RHIME: Tyrosine recombinase XerD (xerD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 80% identity to xau:Xaut_1634)

Predicted SEED Role

"Tyrosine recombinase XerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>GFF3081 Tyrosine recombinase XerD (Xanthobacter sp. DMC5)
MTTPGATAQGPVALFLDMQAVERGAGANTLDAYRRDLTDLADFLAPRAIAAADTQAIRDW
LADLSARGFKATTVARRLSAVRQFFRFLYAEGHRGDDPAAVLEGPRRGRPLPKVLTVEEV
STLIETAHARAAEVPAGEGEAAGKARAEMLKRRRTAAVVELLYASGLRISELVSLPAAAA
RARGDAILVTGKGRKERLVPLSDPARAAMAAYLDARKAAGLEASRWLFPSSGESGYVTRQ
QAARDLKELALAAGLDPAKLSPHVLRHAFASHLLAHGADLRVVQTLLGHADVSTTQIYTH
VLDERLKSMVRDLHPLSDE