Protein Info for GFF308 in Variovorax sp. SCN45

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00106: adh_short" amino acids 6 to 195 (190 residues), 170 bits, see alignment E=8.9e-54 PF01370: Epimerase" amino acids 8 to 79 (72 residues), 21.7 bits, see alignment E=2.4e-08 PF08659: KR" amino acids 9 to 185 (177 residues), 71.7 bits, see alignment E=1.6e-23 PF13561: adh_short_C2" amino acids 13 to 242 (230 residues), 180.5 bits, see alignment E=8.1e-57

Best Hits

Swiss-Prot: 44% identical to FABG_VIBCH: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 92% identity to vpe:Varpa_3230)

MetaCyc: 42% identical to acetoacetyl-CoA reductase subunit (Zoogloea ramigera)
Acetoacetyl-CoA reductase. [EC: 1.1.1.36]; 1.1.1.36 [EC: 1.1.1.36]

Predicted SEED Role

"3-oxoacyl-[ACP] reductase (EC 1.1.1.100)" (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100, 1.1.1.36

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>GFF308 Oxidoreductase, short-chain dehydrogenase/reductase family (Variovorax sp. SCN45)
MSLEGKRALITGASGALGAAMARRFAREGATVLLHANSRPEAVEQLAEAISADGGKAECH
VFDLRSDEACAAACARILEGGSVQILVNNAGVHDDAVLPGMRAEQWHKVIDVSLNGFFRV
TQPLLLPMMRTRWGRILNISSVAAIAGNRGQVNYAAAKGALNSATKALSLEVASRGVTVN
AIAPGIIASPMADAVFDPAVINQMVPVKRAGTPEEVAALAAFLAGNEAGYITGQVISVNG
GMI