Protein Info for GFF3078 in Variovorax sp. SCN45

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 PF13489: Methyltransf_23" amino acids 36 to 155 (120 residues), 44.9 bits, see alignment E=3.8e-15 PF13847: Methyltransf_31" amino acids 50 to 157 (108 residues), 45.2 bits, see alignment E=2.7e-15 PF13649: Methyltransf_25" amino acids 52 to 149 (98 residues), 53.7 bits, see alignment E=1e-17 PF08241: Methyltransf_11" amino acids 53 to 152 (100 residues), 35.5 bits, see alignment E=4.6e-12 PF08242: Methyltransf_12" amino acids 53 to 150 (98 residues), 55.3 bits, see alignment E=3.2e-18 PF10119: MethyTransf_Reg" amino acids 221 to 303 (83 residues), 93.6 bits, see alignment E=3.7e-30 PF21782: PKMT_2nd" amino acids 448 to 530 (83 residues), 62.4 bits, see alignment E=1.6e-20

Best Hits

KEGG orthology group: None (inferred from 82% identity to vpe:Varpa_1788)

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>GFF3078 SAM-dependent methyltransferase (Variovorax sp. SCN45)
MLVPDSLTSTLTRYYDAVPYESHPFPQSAMEHLEALAFLFGLDTPAPAEARVLELGCAAG
GNLIPFAARHPGARAVGLDLSSVQVAQGAAAIAQAGLSNIELKAFDIAEIDASFGQFDYI
VCHGVYSWVPGPVQDAILRICAENLAPNGVAYVSYNVYPGWKAREIVRDAMILRGGPRDT
PDEKLAYARGMLEFLEESARADSVLKKTLEETMPIVRSANSSYLLHEFLEPCNAPCYFKE
FVARAEARGLAYLCDAEPSTMFVQNYGEKVREPLLRECGGSQVLMEQYLDFLVNRTFRQT
LLVGQARAGDIRYRLDPARIRALEVAGLFAAQGGGEFTLDAREQPCNAIRGLTVTLRLPV
HKAVARLLEAAYPASMPVDALIAGVARLVGQPPAAVDHAVMSMLEELLILGALRFRRTPV
PAAASVSGLPRALPAVRSAPGLAPAAGANANACNQWHEPVVLTLLERSLLPLLDGTNSHD
ALAEHLEAEVRSDRLRFVQNDKPLTDPSAVRAFARQQVALALDTLRRKALLTS