Protein Info for GFF3078 in Sphingobium sp. HT1-2

Annotation: Fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 148 to 164 (17 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 215 to 232 (18 residues), see Phobius details PF00487: FA_desaturase" amino acids 58 to 302 (245 residues), 146.9 bits, see alignment E=4.7e-47

Best Hits

KEGG orthology group: None (inferred from 72% identity to sch:Sphch_3915)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>GFF3078 Fatty acid desaturase (Sphingobium sp. HT1-2)
MEDIAQERGPGYRYSRRATLPLIRQLSVVPNWRNALLLALQWAVMIAACTIAIRVDRWPA
YLIAGIVIGTRIQVLAVMMHEACHGMLFSNRRINDLIGDLFVAYPLALSIDLYRVAHMVH
HRHTNTMRDYDYRVQRKDADQHFPKSGRAMVVLLLRSLSGLNYYRAARAARIWSPLSNFH
NPMRFGFDFRLALRVRYIVWAVLVYGAILWSPWRWQILGLFMIPQFIWANVFNRLRAMAE
HNGVTDETEIRGTRTVIPTLIDRILIGPLNVSYHLEHHLFPSVPWHNLRRLHRHLMASDP
RYARDAHVTQGYWGVIRELMPSPAVSGPDRQQGPVEANP