Protein Info for GFF3075 in Sphingobium sp. HT1-2

Annotation: Fluoride ion transporter CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details PF02537: CRCB" amino acids 6 to 120 (115 residues), 90.6 bits, see alignment E=3.6e-30 TIGR00494: protein CrcB" amino acids 7 to 122 (116 residues), 91.6 bits, see alignment E=2.3e-30

Best Hits

Swiss-Prot: 58% identical to CRCB_NOVAD: Putative fluoride ion transporter CrcB (crcB) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K06199, CrcB protein (inferred from 78% identity to sjp:SJA_C1-15390)

Predicted SEED Role

"Protein crcB homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (128 amino acids)

>GFF3075 Fluoride ion transporter CrcB (Sphingobium sp. HT1-2)
MTNIFLVMGGGAVGAALRYLLGRFAGQMAPGAAWPWGTFAANLIGGFAMGLLAGWLARGS
TASGEPMRLLLGVGVLGGFTTFSSFSLETMLMIERGQIGLALGYALFSLVGAVAALALGL
TVMRSVAA