Protein Info for GFF3074 in Xanthobacter sp. DMC5

Annotation: ATM1-type heavy metal exporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 68 to 96 (29 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 173 to 197 (25 residues), see Phobius details amino acids 256 to 282 (27 residues), see Phobius details amino acids 291 to 306 (16 residues), see Phobius details PF00664: ABC_membrane" amino acids 34 to 300 (267 residues), 54 bits, see alignment E=2.1e-18 PF00005: ABC_tran" amino acids 370 to 518 (149 residues), 109.8 bits, see alignment E=1.7e-35

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 85% identity to xau:Xaut_3233)

Predicted SEED Role

"Transport ATP-binding protein CydCD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (599 amino acids)

>GFF3074 ATM1-type heavy metal exporter (Xanthobacter sp. DMC5)
MSLFQTHKRGVSFRAIFAFLFSHWAKRKGIIAATLAAVLVSTLAEVLVPLFAGRLIDALS
LADRETAWHLATMAFLAIVGLGVTMVSARHVTYFIIVRLTLRMMSDVAADAFARVQRFSS
DWHASSFAGSTVRKISRGMWSLDVLHDTLLVALFPSVVALGGTALLLGWNWPVLGAVVAV
GAVAFIGLTLALSLHYVAPAARLSNAWDTRVGGVLADAVGCNAVVKGYGAEAREEERLAR
VLGKWNARTYRTWMAATWAGTAQLLALVALQASIIGTALVLWHQGQASAGDVAYVLTSYL
VIHSYLRDIGMHVHNLQRSMNELEELVEIHHQKVGVSDAPNAVPAQVAEGTIAFENVTFH
YGGHDKPLYENLSVTIPAGERVGLVGHSGSGKTTFVKLIQRMHDVSSGRVIVDGQDVRDV
TQGSLRRAIAVVQQEPVLFHRSLMENIAYGRPDASFEEIRRAAELANAADFIARLPRGYG
TLVGERGVKLSGGERQRIAIARAFLADAPILILDEATSSLDSESEAAIQDAMERLMVGRT
TLVIAHRLSTVRSLDRLMVFDKGRIVEEGDHDTLVRREGGLYRRLFERQAMELAKGLAA