Protein Info for PS417_15730 in Pseudomonas simiae WCS417

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 307 to 330 (24 residues), see Phobius details amino acids 350 to 372 (23 residues), see Phobius details amino acids 378 to 399 (22 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 366 (350 residues), 146.2 bits, see alignment E=6.2e-47

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 92% identity to pba:PSEBR_a3150)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7T5 at UniProt or InterPro

Protein Sequence (416 amino acids)

>PS417_15730 major facilitator transporter (Pseudomonas simiae WCS417)
MTQPRMRQGLVLGMSTLAFTVCFMVWMMFAVLGVPIKDLLQLNETQFGLLAATPVLTGSL
VRLPLGLLTDRFGGRIVFFVLMLACVLPLYLITYATAYWQFLVLGLFVGLAGGSFSVGIA
YVAKWFDKENQGFAMGVFGAGNAGAAVTKFLAPALIALGTWHLVPKVFSAILFVTALLFW
FLTRENKAHRSAGGATLRQQLLCLKDPAVWRYCQYYSIVFGGYVALALWMTKYYVQEYGF
SLQSAALLAACFSLPGGVLRAVGGWMSDRWGAHSVTWWVLWVSWICLFLLSYPQTQLQVM
TVNGPVYFHLGLNATLFTVLLFVMGIAFAFGKASVFKYIANDYPQNMGAVSGIVGLAGGL
GGFVLPILFGALVDLTGVRSSCFMLMYGVVWVSLTWMYISEIRKQPLLGKQALQGE