Protein Info for GFF3073 in Variovorax sp. SCN45

Annotation: Fatty acid hydroxylase family (carotene hydroxylase/sterol desaturase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 135 to 278 (144 residues), 96.8 bits, see alignment E=7.1e-32

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_1793)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>GFF3073 Fatty acid hydroxylase family (carotene hydroxylase/sterol desaturase) (Variovorax sp. SCN45)
VIDWLTDAFSSLQGWFFEAVVQPLVFAVGLGGWTEDAFDATGWLLVGVIQVLVLIAIIGP
LQRWRSVEPVVDRHAIRIDVLYTLIHRLGLFRLAIFFTLQPFFDDAMGSLRTAGWGTFHL
DEVWPGVTDVPVIAFAIYLVVLDFVGYWIHRGQHQLNWWWGLHSLHHSQRQMTMWSDDRN
HLLDDIVHDTLIVIVAQLIGVAPGQFIAFVAFTQLSESLQHANLRLSFGAIGERLWISPR
FHRLHHSIGLGHESNGKSTLGGHNFGVLLPWWDMMFGTANFENRYDPTGIRDQVEPGADG
RVRDYGRGFWAQQWLGLKRMVGRG