Protein Info for GFF3072 in Variovorax sp. SCN45

Annotation: Putative transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 79 to 105 (27 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 223 to 255 (33 residues), see Phobius details PF07264: EI24" amino acids 8 to 218 (211 residues), 103.4 bits, see alignment E=8.7e-34

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_1794)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>GFF3072 Putative transmembrane protein (Variovorax sp. SCN45)
MRLLLDSFWRAVAYCLLPRVIVLSLLPLGLMVLLAAGLGYFYWEAAVAWTRGALDAWPLL
ASFWAWIGRLFSGDVTAMLAPLVVVFAATPLIVVLSLLIVAGFMAPALTRLVGDRRFPSL
EQKKGASFFGSVARSLGVTILALVALVVSMPLWLIPPLVLILPPLIWGWLTYRVMSFDAL
AEHASPEERATLLRTHRLPLLCVGVLCGYLGAAPSIVWASGLLFAAAFFVLVPIAIWIYT
LVFAFSALWFAHYCLDALAQLRAQRAVAAAASGVGGTPALEVAEANKAALSQWGSP