Protein Info for GFF3064 in Sphingobium sp. HT1-2

Annotation: Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03188: phosphoribosyl-ATP diphosphatase
  • amino acids 8 to 91 (84 residues), 108.1 bits, E=1e-35
• PF01503: PRA-PH
  • amino acids 9 to 94 (86 residues), 87.7 bits, E=2.8e-29

Best Hits

Swiss-Prot: 71% identical to HIS2_SPHWW: Phosphoribosyl-ATP pyrophosphatase (hisE) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 76% identity to sch:Sphch_0303)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Protein Sequence (109 amino acids)

>GFF3064 Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (Sphingobium sp. HT1-2)
MQPMRATLQTLEQTIAERRKADPSASYVAKLTARGRGKIAQKVGEEAVEAVIAAMADNRA
ELVGESADLLFHLLVLLADCGIPFDDVLDELDRREGLSGLVEKAARPKD