Protein Info for GFF3063 in Xanthobacter sp. DMC5

Annotation: Glutathione amide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 TIGR01424: glutathione-disulfide reductase" amino acids 6 to 449 (444 residues), 626.9 bits, see alignment E=7.9e-193 PF07992: Pyr_redox_2" amino acids 7 to 320 (314 residues), 226.1 bits, see alignment E=1.4e-70 PF13738: Pyr_redox_3" amino acids 124 to 304 (181 residues), 41.6 bits, see alignment E=1.9e-14 PF00070: Pyr_redox" amino acids 172 to 250 (79 residues), 69.2 bits, see alignment E=7.3e-23 PF02852: Pyr_redox_dim" amino acids 340 to 448 (109 residues), 121.6 bits, see alignment E=3.5e-39

Best Hits

Swiss-Prot: 56% identical to GSHR_BURCE: Glutathione reductase (gor) from Burkholderia cepacia

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 83% identity to xau:Xaut_3224)

Predicted SEED Role

"Glutathione reductase (EC 1.8.1.7)" in subsystem Glutathione: Redox cycle (EC 1.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>GFF3063 Glutathione amide reductase (Xanthobacter sp. DMC5)
MTQREVDLFVIGGGSGGVRAGRIAAQHGAKVMMAEEYRMGGTCVIRGCVPKKLFVYAGRF
AHDIDDMAGFGWRVSAPEFDWPTLVANKDKEIARLEGIYKRNAEAAGVEIVASRAVVAGP
NRVRILETGEEVAARHILLATGAHPALGPQIPGCELAITSNEAFNLPRFPDRILIQGAGY
IAVEFAGLFRALGAEVTLVYRGDKVLRGFDMEVREHLETEMTRAGIKLVSGKTLTSIEAI
SGGKRVVLSDGSELEVDEVMLAIGRIPSTRNLGLEAVGVALDELGAVVVDAHSRTSVPSI
YAVGDITNRINLTPVAIREGHAFADTVFGNKPWTVDHSLVATAVFSEPEIGTVGCTEEAA
RAAGRPVDIYKTSFRPLKATLSGRETRSFMKLIVDGETDQVLGVHIMGEAAGEMIQLAAV
AMGLKATKADFDRTIAVHPTAAEELVTLRTKAS