Protein Info for GFF3063 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG002060: uncharacterized protein YggL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 PF04320: YggL_50S_bp" amino acids 7 to 107 (101 residues), 144 bits, see alignment E=1.3e-46

Best Hits

Swiss-Prot: 95% identical to YGGL_ECOLI: Uncharacterized protein YggL (yggL) from Escherichia coli (strain K12)

KEGG orthology group: K09923, hypothetical protein (inferred from 95% identity to eum:ECUMN_3314)

Predicted SEED Role

"FIG002060: uncharacterized protein YggL"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>GFF3063 FIG002060: uncharacterized protein YggL (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAKNRSRRLRKKMHIDEFQELGFSVAWRFPEGTSEEQVDKTVDDFINDVIEPNKLAFDGS
GYLAWEGLICMQEIGKCTEEHQAIVRKWLEARNLEEVRTSELFDVWWD