Protein Info for GFF3062 in Sphingobium sp. HT1-2

Annotation: Imidazole glycerol phosphate synthase cyclase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit" amino acids 4 to 252 (249 residues), 328.1 bits, see alignment E=1.6e-102 PF00977: His_biosynth" amino acids 6 to 235 (230 residues), 270.8 bits, see alignment E=4.4e-85

Best Hits

Swiss-Prot: 84% identical to HIS6_SPHAL: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 93% identity to sch:Sphch_0305)

MetaCyc: 47% identical to imidazole-glycerol-phosphate synthase cycloligase subunit (Thermotoga maritima)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 4.1.3.- or 4.3.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>GFF3062 Imidazole glycerol phosphate synthase cyclase subunit (Sphingobium sp. HT1-2)
MTVRTRVIPCLDVANGRVVKGVNFVDLKDAGDPVEQAKLYDAAGADELCFLDITATHEAR
GTILDVVRRTAEVCFMPVTVGGGVRSAEDARALLLAGADKVAVNSAAVARPELVADIADR
FGAQCIVGSVDARKVGEGRWEIFTHGGRKPTGIDALEHALRLAELGAGELLVTSMDGDGT
KQGYDLALTRMIADGVSIPVIASGGVGTLDHLVAGVVEGHASAVLAASIFHFGQHTIAES
HQALARAGIPVRGH