Protein Info for GFF3054 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Hypothetical protein YggS, proline synthase co-transcribed bacterial homolog PROSC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00044: pyridoxal phosphate enzyme, YggS family
  • amino acids 1 to 229 (229 residues), 331.1 bits, E=1.8e-103
• PF01168: Ala_racemase_N
  • amino acids 8 to 229 (222 residues), 80.8 bits, E=6.1e-27

Best Hits

Swiss-Prot: 89% identical to PLPHP_ECOL6: Pyridoxal phosphate homeostasis protein (yggS) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06997, (no description) (inferred from 99% identity to seh:SeHA_C3339)

Predicted SEED Role

"Hypothetical protein YggS, proline synthase co-transcribed bacterial homolog PROSC"

Protein Sequence (234 amino acids)

>GFF3054 Hypothetical protein YggS, proline synthase co-transcribed bacterial homolog PROSC (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNDIAHNLAYIRDKISAAATRCGRSSEEVTLLAVSKTKPASDIAEAIAAGQRAFGENYVQ
EGVEKIRHFQEAKVEGLHWHFIGPLQSNKSRLVAEHFDWCHTIDRLRIASRLSEQRPDNL
PALNVLIQINISDENSKSGIPLAELDELAAAVATLPRLRLRGLMAIPAPESDYVRQFEVA
RQMAVAFAGLKARYPDVDTLSLGMSDDMEAAIAAGSTMVRIGTAIFGARDYTKN