Protein Info for GFF3049 in Variovorax sp. SCN45

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00106: adh_short" amino acids 7 to 186 (180 residues), 155.3 bits, see alignment E=3.5e-49 PF08659: KR" amino acids 8 to 158 (151 residues), 31.8 bits, see alignment E=3.3e-11 PF01370: Epimerase" amino acids 9 to 153 (145 residues), 34.6 bits, see alignment E=3.6e-12 PF13561: adh_short_C2" amino acids 13 to 215 (203 residues), 117.3 bits, see alignment E=2.2e-37 PF13460: NAD_binding_10" amino acids 13 to 140 (128 residues), 31.4 bits, see alignment E=4.4e-11

Best Hits

KEGG orthology group: None (inferred from 95% identity to vap:Vapar_6368)

MetaCyc: 36% identical to clavulanate dehydrogenase subunit (Streptomyces clavuligerus)
RXN-8893

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>GFF3049 Oxidoreductase, short-chain dehydrogenase/reductase family (Variovorax sp. SCN45)
MPFSDYKTALVTGASSGIGAAVVERLSKEGLKVHALARSADKLADLAARTGCIAHAIDVS
DLAGITRLAQEVEFDVLVNNAGVDRPGSILKADAEGIDLLVDVNLRAVLHLCRLVVPGMA
ARDRGHVVNISSIAAAYNFGGNSTYHATKAAVSMLSRQLRIDCFGKRVRVTEICPGRVAT
DIFAHVHGDSEETYKRFVEGYELPQAEDIANAIAFAIAAPIAVNVGHMEITPTLQVPGGL
STTRPETPRD