Protein Info for GFF3049 in Sphingobium sp. HT1-2

Annotation: Transcriptional regulator, Crp/Fnr family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00027: cNMP_binding" amino acids 56 to 139 (84 residues), 47.5 bits, see alignment E=2.1e-16 PF13545: HTH_Crp_2" amino acids 172 to 247 (76 residues), 68.8 bits, see alignment E=4.9e-23 PF00325: Crp" amino acids 198 to 229 (32 residues), 46.2 bits, see alignment 4.5e-16

Best Hits

Swiss-Prot: 42% identical to FIXK_BRADU: Nitrogen fixation regulation protein FixK (fixK) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 76% identity to sch:Sphch_3400)

Predicted SEED Role

"cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>GFF3049 Transcriptional regulator, Crp/Fnr family (Sphingobium sp. HT1-2)
MNMHFDLAQTLPGGMPVPGPCSDASFCQRCEVRDRAICATLEEDERGALNRLGRRVTIAA
GQTVMWEGDDATIVANVIDGTLKLSASTGDGREQIVGVVYPSDFIGRPFGRSTPHSVTAL
TDARLCLFTRGAFDGFAREHPELEHRLLQRTLDDLDRARSWMLLLGRKNAREKIATFLLD
MSRRLAREGQPPLDRFNLPLSRQQIADVLGLTIETVSRQLTDLKRIGIIALPGRRMVEIR
DRAALLDCSEAA