Protein Info for GFF3047 in Variovorax sp. SCN45

Annotation: Glutamate/aspartate ABC transporter, permease protein GltK (TC 3.A.1.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 26 to 52 (27 residues), see Phobius details amino acids 64 to 89 (26 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 27 to 119 (93 residues), 85.8 bits, see alignment E=1.2e-28 PF00528: BPD_transp_1" amino acids 43 to 226 (184 residues), 79.2 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 95% identity to vap:Vapar_6370)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>GFF3047 Glutamate/aspartate ABC transporter, permease protein GltK (TC 3.A.1.3.4) (Variovorax sp. SCN45)
MYSVYEILRDNWLLLLVGQYPSGPLGGIVATLILSVLGIVLAFPLSVLLALARLSPWRLL
RWPATVLVYVVRGVPLLMVILWVYFLVPILIGREVSGFTTMLCTLVIYEGAYLSEVVRAG
ILSLPKGQSEAARALGHSHLGTMWFVILPQALYNMLPSMLSQFISTIKETTLGYVINVQE
LTFAANQINNQLLTKPFQVFFILALTYYVVCFSLTQLAQWLERRIAHKRLGATPVKPAEE
GASLPTSPATPAPTVATLP