Protein Info for PS417_01545 in Pseudomonas simiae WCS417

Annotation: adenine glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR01084: A/G-specific adenine glycosylase" amino acids 5 to 277 (273 residues), 365.9 bits, see alignment E=7.8e-114 PF00730: HhH-GPD" amino acids 35 to 166 (132 residues), 78.9 bits, see alignment E=5.5e-26 PF00633: HHH" amino acids 99 to 127 (29 residues), 26 bits, see alignment (E = 8.7e-10) PF14815: NUDIX_4" amino acids 237 to 343 (107 residues), 75 bits, see alignment E=6.4e-25

Best Hits

Swiss-Prot: 54% identical to MUTY_ECOLI: Adenine DNA glycosylase (mutY) from Escherichia coli (strain K12)

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 99% identity to pfs:PFLU0323)

MetaCyc: 54% identical to adenine DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-2661 [EC: 3.2.2.31]

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.- or 3.2.2.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0Y5 at UniProt or InterPro

Protein Sequence (355 amino acids)

>PS417_01545 adenine glycosylase (Pseudomonas simiae WCS417)
MRDEQFSTAVLDWYDRHGRHDLPWQQGITPYRVWVSEIMLQQTQVSTVLNYFDRFMASLP
TVEALAAAPEDEVLHLWTGLGYYTRARNLQKTAKIVVAEYGGEFPKDVEKLTELPGIGLS
TAGAIASLSMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFTPHDRVNAY
TQAMMDMGATLCTRSKPSCLLCPLEKGCEAHMLGLETRYPIPKPRKTIPQKRTLMPLLAN
AEGAILLYRRPSTGLWGGLWSLPELDDLQDLEHLANQHALALGKHQELPGLIHTFSHFQL
AIEPWLVQVEESAHHVAEADWLWYNLATPPRLGLAAPVKKLLKRAADVLNAGVSS