Protein Info for PS417_15500 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details

Best Hits

Swiss-Prot: 56% identical to MDDA_PSEDM: Methanethiol S-methyltransferase (mddA) from Pseudomonas deceptionensis

KEGG orthology group: None (inferred from 49% identity to met:M446_6423)

MetaCyc: 56% identical to methanethiol S-methyltransferase (Pseudomonas deceptionensis)
RXN-17813 [EC: 2.1.1.334]

Predicted SEED Role

"putative conserved integral membrane protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.334

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UD02 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PS417_15500 membrane protein (Pseudomonas simiae WCS417)
MNPQTHADSLPARLVGLVYSIACYVVFLLTFLYLMGFLGSVVVPKNINAGRLIDWPLATL
INGLLIILFGLQHSVMARKRFKSRLTALIPTAAERSTYVLFSSLVLGVMFWLWHPITYQV
WHIETAWARALITGLFWAGWAIVLLATLLISHFELFGLKQAIDRWRDTAQHAPVFRTPLL
YKIIRHPLYLGFLIAFWATPDMTVGHLQFAMGLTVYLFIGTYFEEKDLTVLFGDRYREYQ
GEVSMIFPMPKRRSK