Protein Info for GFF3028 in Xanthobacter sp. DMC5

Annotation: Methanol dehydrogenase [cytochrome c] subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF02315: MDH" amino acids 14 to 98 (85 residues), 151.5 bits, see alignment E=2.9e-49

Best Hits

Swiss-Prot: 64% identical to DHM2_METEA: Methanol dehydrogenase [cytochrome c] subunit 2 (moxI) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: K14029, methanol dehydrogenase (cytochrome c) subunit 2 [EC: 1.1.2.7] (inferred from 74% identity to sno:Snov_4191)

MetaCyc: 64% identical to methanol dehydrogenase small subunit (Methylorubrum extorquens AM1)
1.1.2.7,1.1.2.e [EC: 1.1.2.7, 1.1.2.e]; 1.1.2.7 [EC: 1.1.2.7, 1.1.2.e]

Predicted SEED Role

"Methanol dehydrogenase, small subunit (EC 1.1.99.8)" (EC 1.1.99.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.7, 1.1.99.8

Use Curated BLAST to search for 1.1.2.7 or 1.1.2.e or 1.1.99.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (102 amino acids)

>GFF3028 Methanol dehydrogenase [cytochrome c] subunit 2 (Xanthobacter sp. DMC5)
MKHKVRMSVLAAAAAFAVTALAAGSAAAYDGTNCRAPGNCWEPKPGYPDKVAGSKYDPKH
NPAELAKQGESITQMEERNKKRVDYFQKTGQFVYDVSKIPSN