Protein Info for GFF3025 in Variovorax sp. SCN45

Annotation: Proton/sodium-glutamate symport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 75 to 99 (25 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 340 to 359 (20 residues), see Phobius details amino acids 367 to 390 (24 residues), see Phobius details amino acids 400 to 418 (19 residues), see Phobius details amino acids 444 to 465 (22 residues), see Phobius details PF00375: SDF" amino acids 13 to 413 (401 residues), 140.4 bits, see alignment E=4.1e-45

Best Hits

KEGG orthology group: None (inferred from 51% identity to reu:Reut_A1719)

Predicted SEED Role

"Proton/sodium-glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>GFF3025 Proton/sodium-glutamate symport protein (Variovorax sp. SCN45)
MGFLTRMSHSLLALLLCMAAGGVAGIYAPAVGDVAYTAAQVYLSIVSMAAIPLLVVATFF
GLRQTMGLPFPARRIAMIAGLALLLVASCAATGLALGWVNSPGAHLDADLREHLGELVQK
AGDGGDMEMRLYDNGVQATPVERPRATLLPDNFFRALVEGRSLGILSCALLFGLAFAALA
RTQHNALNHMFEGIYRTLELIIARANILLPVVAFGMSAHVFSETDAVTIRAMLGFLLHFV
VLVALLGMAAIAVIHRRGNQPLVEVLQHLKTPMLVSLVSSSTTASIPHTIEAMSARLGFS
RGIVELVVPTASVFLRAGSALYYVLLALFVANLYDRTLSAADIGMIGTGATVAAFASAGN
NSLTNVGYAGIVLSLLQLPIEAALALFLAIDLICEGPRNLLTLLASCALIAIVSAGLPSE
RVTAPAADTAPVQPLRFVLTRGNVYLLAGCSVLASLLILLMGIAVGARQAVQPSAAYATS
AAANPGISR