Protein Info for GFF3025 in Sphingobium sp. HT1-2

Annotation: Efflux transport system, outer membrane factor (OMF) lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 14 to 466 (453 residues), 409 bits, see alignment E=1.3e-126 PF02321: OEP" amino acids 73 to 259 (187 residues), 122.4 bits, see alignment E=9.4e-40 amino acids 283 to 466 (184 residues), 126.9 bits, see alignment E=4.1e-41

Best Hits

KEGG orthology group: None (inferred from 76% identity to swi:Swit_4652)

Predicted SEED Role

"Heavy metal RND efflux outer membrane protein, CzcC family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>GFF3025 Efflux transport system, outer membrane factor (OMF) lipoprotein (Sphingobium sp. HT1-2)
MRADRRIGGAGVTLAAVLLAGCSMAPAYQPPQTSAPAEYKEVAGWTAAQPADATPRGNWW
EAFNDPVLNDLESRAEQASPTLAAALARYDQARAAARVENADLFPQISAGADAGHRRVSG
NRFQGNGSAVTYNDYVVGGSLDYELDLWGRIRNSVKAARADADASNADLASARLSLQAAV
ADAYARLRGLDAQAELLHQTVEAFGKAYDLTDRRHKGGVSSGIDVNRAKTVLDNAKADIS
AIANERAATEHEIAALVGAIASDFSIAARTQPLAAPDVPTGAPSQLLERRPDIAAAERRM
FAANARIGVAKAAFFPTLTLGLTGGWETTHGDLFSAPNSFWGLGPASALLNLFDGGKRRA
QVKMSRAEYEELAAGYRDTVLTAFRQVEDAVAANHHLSDQIGHQRSAADAAQRTSDLALT
RYRDGASDYLEVVTAQTDALDAQRAVLIAQTQRMRASVALAKALGGAA