Protein Info for GFF3025 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transmembrane component STY3231 of energizing module of queuosine-regulated ECF transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 49 to 70 (22 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details

Best Hits

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 98% identity to sed:SeD_A3415)

Predicted SEED Role

"Transmembrane component STY3231 of energizing module of queuosine-regulated ECF transporter" in subsystem ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>GFF3025 Transmembrane component STY3231 of energizing module of queuosine-regulated ECF transporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MHPFTSLTLWALAACTTLLLPAQTVLPVYSAAAFLCLLALKSTRRRAKYVAWLMLSLGFG
LWLVHGGWLTEWISGQPRDPQRWVYAVTLWLRLLAIVSTSQLWMQYVPVQRFIRALFASR
LPPGIAYLFAGPLLVVEQLKRQLTIVHEAQRARGVPLDEGWYQRLRAMPALIVPLTQNAL
NDLTIRGAALDMRGFRLHRARTTLWAPKDSVLQRVARYGMVLLILAEAGVWIWLR