Protein Info for GFF302 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glutamyl-tRNA synthetase (EC 6.1.1.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 87 to 104 (18 residues), see Phobius details PF00749: tRNA-synt_1c" amino acids 5 to 311 (307 residues), 310.5 bits, see alignment E=1.1e-96 TIGR00464: glutamate--tRNA ligase" amino acids 5 to 460 (456 residues), 531.4 bits, see alignment E=1.1e-163 PF19269: Anticodon_2" amino acids 330 to 461 (132 residues), 90.3 bits, see alignment E=1.6e-29

Best Hits

Swiss-Prot: 84% identical to SYE_RHOFT: Glutamate--tRNA ligase (gltX) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 84% identity to rfr:Rfer_2681)

Predicted SEED Role

"Glutamyl-tRNA synthetase (EC 6.1.1.17)" in subsystem Heme and Siroheme Biosynthesis or tRNA aminoacylation, Glu and Gln (EC 6.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>GFF302 Glutamyl-tRNA synthetase (EC 6.1.1.17) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSAPIRTRFAPSPTGFIHLGNIRSALYPWAFARSTGGAFILRIEDTDLERSSQAAVDVII
EGMKWLGLDHDEGPFYQMQRMDRYKAVLAEMVAGGLVYPCYMSVAELDALREKQMAAKEK
PRYDGTWRPEPGKTLPPVPEGVKPVLRFKNPQGGVVAWDDKVKGRIEIRNDELDDLVIAR
PDGTPTYNFCVVVDDIDMAISHVIRGDDHVNNTPRQINIFRALGKEPPVYAHLPTVLNEQ
GEKMSKRNGAKPVTQYRDEGYLPDAMVNYLARLGWSHGDDEIFSRAQFLEWFNLDHLGRS
AAQFDEAKLKWVNAQHLKAMADDALAPLVAAHLQQQGIEADARLPRICGLFKDRCDTTVA
LAGWAKAFYADITPNAEERAQHVTDAVRPVLVTLADKLAACAWDKAALSAAIKEVLAAHG
LKMPQLAMPVRVLVMGTAQTPSLDAVLELHDREVVLRRLQNG