Protein Info for GFF302 in Methylophilus sp. DMC18

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 77 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 44 to 70 (27 residues), see Phobius details PF13441: Gly-zipper_YMGG" amino acids 15 to 74 (60 residues), 41.7 bits, see alignment E=1.4e-14 PF05433: Rick_17kDa_Anti" amino acids 38 to 74 (37 residues), 31.6 bits, see alignment E=1.9e-11

Best Hits

Swiss-Prot: 56% identical to OSMB_ECOLI: Osmotically-inducible lipoprotein B (osmB) from Escherichia coli (strain K12)

KEGG orthology group: K04062, osmotically inducible lipoprotein OsmB (inferred from 63% identity to mei:Msip34_0360)

Predicted SEED Role

"Osmotically inducible lipoprotein B precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (77 amino acids)

>GFF302 hypothetical protein (Methylophilus sp. DMC18)
MKKPSPVSLQKSLVWTALLVLTLSTSACGSMSTRGKNTAIGAGVGAVAGAVLTGGSSIGT
VGGAAVGGVIGNQIHKK