Protein Info for PS417_15450 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 58 to 83 (26 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 78 to 263 (186 residues), 57.2 bits, see alignment E=9.7e-20

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 98% identity to pfs:PFLU3576)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCZ3 at UniProt or InterPro

Protein Sequence (272 amino acids)

>PS417_15450 ABC transporter permease (Pseudomonas simiae WCS417)
MAASSRHAAWALAPAFAVLLAFWLLPLAHLVVLGADSRDSNGSGYWQVLSSAQYLGSLGQ
TLVLAVVVTLVALVIGGISGVFLARQQFFGRSALVALLTFPLAFPGVVVGFLVILLAGRQ
GLLASLGLQLAGERWIFAYSLAGLFVGYLYFSIPRVILTVMAACESLDRSLEEAAHSLGA
GHWRVVCDVIVPGLAPALASCGAICFATSMGAFGTAFTLGTRLNVTPVAIYNVFTNYANF
AVAAALSVVLGVVTWAVLLLTRRLVKNAGTVL