Protein Info for PS417_15440 in Pseudomonas simiae WCS417

Annotation: iron ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 322 to 341 (20 residues), see Phobius details PF00005: ABC_tran" amino acids 23 to 165 (143 residues), 135.1 bits, see alignment E=3.9e-43 PF08402: TOBE_2" amino acids 274 to 338 (65 residues), 31.8 bits, see alignment E=1.9e-11

Best Hits

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 96% identity to pfs:PFLU3574)

Predicted SEED Role

"Maltose maltodextrin transport ATP-binding protein malK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7ULZ0 at UniProt or InterPro

Protein Sequence (343 amino acids)

>PS417_15440 iron ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MTAITIRLQGCRKAFADGTVAVHDLNLTVEGGETLAILGPSGCGKTTTLRLIAGLERPDV
GQVLFGDQDVTRLPIERRDVGMVFQNYALFPNLNVAGNIVYGLKIRGMGGVEREKRCEEL
LELVGLQHHGKRSIHELSGGQRQRVALARALAPRPKVLLLDEPLAALDAQLRERLRSELN
DLLRGLGITSVFVTHDQGEAMALGDRILVMEHGRVAQLASPRDIYHKPANAFVAGFVGNL
NAFPVIEPSAHGLKVCGGELPWHAAELPSTVYCRPEHLRVMEGEGHLHGHLLAQFFQGAQ
SRLLVDVGGPQPLLVDSSDNQLYAVGAPIALAIAPHMLFTLNA