Protein Info for GFF3015 in Xanthobacter sp. DMC5

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 179 to 207 (29 residues), see Phobius details amino acids 223 to 250 (28 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 273 (265 residues), 113.4 bits, see alignment E=5.3e-37

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 52% identity to reu:Reut_C6212)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF3015 High-affinity branched-chain amino acid transport system permease protein LivH (Xanthobacter sp. DMC5)
MTFWVSQSLNALALGGLLFMLASGFSLIFGLMRVANLAHGALFMLGAYLGLAAVKAGFGF
WAAAATAAVAVGLLGGIIERTLLRRLAGRTLPQVLLTLGLAFIIADACLMTWGGDPMRLP
PPPELSGAVRIGDAVFPRYRLFVIGASAAVALGLWLLVERTRAGAMIRAAVDDVGMARAI
GVSASTLFTAVFCLGTALAGLGGVIGGPILSVYPSLDQDMLPLALLVVILGGAGSLVGAF
VGAYAIGFIYTFGQVLVPDLAYVILFLPMIAVLSVAPQGLFGRRLG